PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi05g02690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HB-PHD
Protein Properties Length: 714aa    MW: 81658.7 Da    PI: 9.0559
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi05g02690.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.99.2e-105015431153
                      HHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
         Homeobox  11 qleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                       +e L ++F++n  p ++ +e L+k+lgL+ ++V+ WF+N R+
  Vradi05g02690.1 501 AVEKLRQVFAENELPPRSVKEGLSKELGLDPEKVSKWFKNARY 543
                      5789*************************************97 PP

2PHD39.71.1e-13235290151
                      SBTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
              PHD   1 rCkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                      +C+ C+   +  +++++lCd +C+++fH+ Cl+++l++e++p g   w+C+ C++k
  Vradi05g02690.1 235 FCANCKLheAFPDNDIILCDgTCNRAFHQRCLNPPLDTENIPPGdqGWFCKFCECK 290
                      699999954445********56********************9999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579033.1E-14227292IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.9E-12232291IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.558233290IPR019787Zinc finger, PHD-finger
CDDcd155042.09E-29235287No hitNo description
PfamPF006281.1E-10235290IPR019787Zinc finger, PHD-finger
SMARTSM002493.8E-9235288IPR001965Zinc finger, PHD-type
PROSITE patternPS013590236287IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.601.5E-10482542IPR009057Homeodomain-like
PROSITE profilePS5007111.143488548IPR001356Homeobox domain
SMARTSM003898.7E-6490552IPR001356Homeobox domain
SuperFamilySSF466893.08E-9491557IPR009057Homeodomain-like
CDDcd000866.42E-7496543No hitNo description
PfamPF000462.2E-7501543IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 714 aa     Download sequence    Send to blast
MRDAENLNKK GSGKSSYSKE QIKSKLFSSK LKASSTKNRR KEHKEKSRSH KLRVGTNTSK  60
KRVADSSIKA PLEDSSNKKV IIRKTLHKTD ENSSRMVSST KLQGRKNPHI SRKEGNGVDE  120
EAKIKKRKRN KKKSRQRDSM DHDDASRLRR RTRYLLIKMK LEQNLIDAYS GEGWKGQSRE  180
KIRPEKELLR AKKQILKCKL SIRDVIRQLD SLSSVGSIED SVIAPDGSVY HEHIFCANCK  240
LHEAFPDNDI ILCDGTCNRA FHQRCLNPPL DTENIPPGDQ GWFCKFCECK IEIIESTNAH  300
LGTQFSLDSS WQDIFKEEAA VPDGDIALLS PEEEWPSDDP EDDDYNPERK EDSHSINTEG  360
ADENASNDST SSLSLWSLNE ECPPVDEDLS RQYYSVNSFI DSDESGEIAC GRRQRKAVDY  420
KKLYDEMFGK DAPPCEQPSE DEDWGPGKRK RREKESDAVN TLMTLHESEN KHPNNESSDR  480
IREGSSGLQI RRSCFRIPLD AVEKLRQVFA ENELPPRSVK EGLSKELGLD PEKVSKWFKN  540
ARYLALKTRK YQSEEQLQSF TSQISKHSTS PNMEKDEFLK SQAPKITLVH SQKDGQSITG  600
QEKNKLCNSL LKRRKQKPSP PLSRENSNKE SMEMSDDVNL KKLLKERKKR VNFIYEGDSQ  660
IAELEFERLS KVKSKVDSMK QKLNEVQNCR AKGSTNEPSI IYVPTAQLRE KVE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1123130IKKRKRNK
2124131KKRKRNKK
3448453RKRREK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014498891.10.0PREDICTED: pathogenesis-related homeodomain protein
SwissprotP487851e-155PRH_ARATH; Pathogenesis-related homeodomain protein
TrEMBLA0A0S3RHN60.0A0A0S3RHN6_PHAAN; Uncharacterized protein
STRINGGLYMA15G17956.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF52753349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.11e-153pathogenesis related homeodomain protein A